PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bv3_061350_fahh.t2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Betoideae; Beta
Family NF-YA
Protein Properties Length: 186aa    MW: 21122.6 Da    PI: 7.9498
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bv3_061350_fahh.t2genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA51.63.1e-16128163238
           CBFB_NFYA   2 eplYVNaKQyqrIlkRRqkRakleeekkldeksrkpy 38 
                         ep+YVNaKQy++Il+RRq+Rak+e e+++ +k+rk  
  Bv3_061350_fahh.t2 128 EPIYVNAKQYHGILRRRQSRAKAELENRV-AKARKAC 163
                         8****************************.9999875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005215.5E-8125181IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115217.215126161IPR001289Nuclear transcription factor Y subunit A
PfamPF020456.5E-13128162IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860131151IPR018362CCAAT-binding factor, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 186 aa     Download sequence    Send to blast
MNQKAEQYFS SKSSSTSHSH SQVICWSDNF LNDPPSSSSY LSMECSSNLN YSFHEDSNNP  60
IVSLGKYGEQ PKQELQLGIF PMDHPQMIHE YHMPGSNQAG LSHHNTGYYE GMHSSGGVPL  120
PGEAANYEPI YVNAKQYHGI LRRRQSRAKA ELENRVAKAR KACILIRRKC EYNCSHIFMN  180
LGIYMQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010672781.11e-138PREDICTED: nuclear transcription factor Y subunit A-9-like isoform X2
SwissprotQ945M91e-14NFYA9_ARATH; Nuclear transcription factor Y subunit A-9
TrEMBLA0A0J8FHP81e-138A0A0J8FHP8_BETVU; Uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G20910.13e-15nuclear factor Y, subunit A9